General Information

  • ID:  hor006694
  • Uniprot ID:  Q9IA10
  • Protein name:  Progonadoliberin-1
  • Gene name:  gnrh1
  • Organism:  Dicentrarchus labrax (European seabass) (Morone labrax)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Dicentrarchus (genus), Moronidae (family), Eupercaria incertae sedis, Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSYGLSPGGKRELDGLSETLGNQIVGSFPHVATPCRVLGCAEESPFPKIYRMKGFLDAVTDRENGNRTYKK
  • Length:  73(27-99)
  • Propeptide:  MAAQTFALRLLLVGTLLGTLLGQGCCQHWSYGLSPGGKRELDGLSETLGNQIVGSFPHVATPCRVLGCAEESPFPKIYRMKGFLDAVTDRENGNRTYKK
  • Signal peptide:  MAAQTFALRLLLVGTLLGTLLGQGCC
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9IA10-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006694_AF2.pdbhor006694_ESM.pdb

Physical Information

Mass: 939658 Formula: C358H557N103O107S3
Absent amino acids: Common amino acids: G
pI: 8.74 Basic residues: 12
Polar residues: 26 Hydrophobic residues: 19
Hydrophobicity: -65.48 Boman Index: -14499
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 62.74
Instability Index: 2737.95 Extinction Coefficient cystines: 10095
Absorbance 280nm: 140.21

Literature

  • PubMed ID:  11086295
  • Title:  Differential expression of three different prepro-GnRH (gonadotrophin-releasing hormone) messengers in the brain of the european sea bass (Dicentrarchus labrax).